Lineage for d5ol2f1 (5ol2 F:1-227)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2219439Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. 2219440Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. 2219585Family e.6.1.0: automated matches [227203] (1 protein)
    not a true family
  6. 2219586Protein automated matches [226934] (25 species)
    not a true protein
  7. 2298805Species Clostridioides difficile [TaxId:1496] [342106] (1 PDB entry)
  8. 2298806Domain d5ol2f1: 5ol2 F:1-227 [342107]
    Other proteins in same PDB: d5ol2b_, d5ol2c2, d5ol2e_, d5ol2f2
    automated match to d4l1fa1
    complexed with ca, cos, fad

Details for d5ol2f1

PDB Entry: 5ol2 (more details), 3.1 Å

PDB Description: the electron transferring flavoprotein/butyryl-coa dehydrogenase complex from clostridium difficile
PDB Compounds: (F:) acyl-CoA dehydrogenase

SCOPe Domain Sequences for d5ol2f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ol2f1 e.6.1.0 (F:1-227) automated matches {Clostridioides difficile [TaxId: 1496]}
mdlnskkyqmlkelyvsfaenevkplateldeeerfpyetvekmakagmmgipypkeygg
eggdtvgyimaveelsrvcgttgvilsahtslgswpiyqygneeqkqkflrplasgeklg
afgltepnagtdasgqqttavldgdeyilngskifitnaiagdiyvvmamtdkskgnkgi
safivekgtpgfsfgvkekkmgirgsatselifedcripkenllgke

SCOPe Domain Coordinates for d5ol2f1:

Click to download the PDB-style file with coordinates for d5ol2f1.
(The format of our PDB-style files is described here.)

Timeline for d5ol2f1:

  • d5ol2f1 appears in periodic updates to SCOPe 2.06 starting on 2017-11-30