SCOPe 2.08: Domain d5ol2e_: 5ol2 E:

Lineage for d5ol2e_ (5ol2 E:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families)
   share similar mode of ligand (Adenosine group) binding
   can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

5. Family c.26.2.0: automated matches [191320] (1 protein)
   not a true family

6. Protein automated matches [190116] (28 species)
   not a true protein

7. Species Clostridioides difficile [TaxId:1496] [342102] (1 PDB entry)

8. Domain d5ol2e_: 5ol2 E: [342103]
   Other proteins in same PDB: d5ol2c1, d5ol2c2, d5ol2f1, d5ol2f2
   automated match to d4l2ib_
   complexed with ca, cos, fad

Details for d5ol2e_

PDB Entry: 5ol2, 3.1 Å

PDB Description: the electron transferring flavoprotein/butyryl-coa dehydrogenase complex from clostridium difficile

PDB Compounds: (E:) Electron transfer flavoprotein small subunit

SCOPe Domain Sequences for d5ol2e_:

Sequence; same for both SEQRES and ATOM records:

>d5ol2e_ c.26.2.0 (E:) automated matches {Clostridioides difficile [TaxId: 1496]}
mnivvcikqvpdttevkldpntgtlirdgvpsiinpddkagleeaiklkeemgahvtvit
mgppqadmalkealamgadrgilltdrafagadtwatssalagalknidfdiiiagrqai
dgdtaqvgpqiaehlnlpsityaeeiktegeyvlvkrqfedcchdlkvkmpclittlkdm
ntprymkvgriydafendvvetwtvkdievdpsnlglkgsptsvfksftksvkpagtiyn
edaktsagiiidklkekyii

Timeline for d5ol2e_:

• d5ol2e_ first appeared in SCOPe 2.06
  
• d5ol2e_ appears in SCOPe 2.07