Lineage for d5ojna1 (5ojn A:32-313)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2107255Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 2107256Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 2107620Family c.31.1.0: automated matches [191352] (1 protein)
    not a true family
  6. 2107621Protein automated matches [190312] (11 species)
    not a true protein
  7. 2298788Species Xenopus tropicalis [TaxId:8364] [342089] (2 PDB entries)
  8. 2298799Domain d5ojna1: 5ojn A:32-313 [342100]
    Other proteins in same PDB: d5ojna2
    automated match to d2b4ya1
    complexed with 9x8, zn

Details for d5ojna1

PDB Entry: 5ojn (more details), 1.8 Å

PDB Description: sirtuin 4 from xenopus tropicalis in complex with thioacetyl-adp- ribose
PDB Compounds: (A:) NAD-dependent protein deacylase

SCOPe Domain Sequences for d5ojna1:

Sequence, based on SEQRES records: (download)

>d5ojna1 c.31.1.0 (A:32-313) automated matches {Xenopus tropicalis [TaxId: 8364]}
vpacpppnphqveqlqdfvsqsqrlfvmtgagistesgipdyrsegvglysrterrpiqh
sefvqsqaarrrywarnfvgwpsfsshepnsahvnlckweragrlhwlvtqnvdalhtka
gqcrlselhgcthrviclgcqtvtkrselqerflnlnpswneqahglapdgdvfltdeqv
sdfqvpactkcggilkpqvtffgdtvnrgfvfsiyeqmkqadamlivgsslqvysgyrfa
lnakelhlpiailnigptradhlakvkvsarcgdvlphillq

Sequence, based on observed residues (ATOM records): (download)

>d5ojna1 c.31.1.0 (A:32-313) automated matches {Xenopus tropicalis [TaxId: 8364]}
vpacpppnphqveqlqdfvsqsqrlfvmtgagistesgipdyrsegvglysrterrpiqh
sefvqsqaarrrywarnfvgwpsfsshepnsahvnlckweragrlhwlvtqnvdalhtka
gqcrlselhgcthrviclgcqtvtkrselqerflnlnpswneltdeqvsdfqvpactkcg
gilkpqvtffgdtvnrgfvfsiyeqmkqadamlivgsslqvysgyrfalnakelhlpiai
lnigptradhlakvkvsarcgdvlphillq

SCOPe Domain Coordinates for d5ojna1:

Click to download the PDB-style file with coordinates for d5ojna1.
(The format of our PDB-style files is described here.)

Timeline for d5ojna1:

  • d5ojna1 appears in periodic updates to SCOPe 2.06 starting on 2017-11-30

View in 3D
Domains from same chain:
(mouse over for more information)
d5ojna2