Lineage for d5ofna_ (5ofn A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2215014Fold d.264: Prim-pol domain [56746] (1 superfamily)
    consists of two alpha+beta domains
  4. 2215015Superfamily d.264.1: Prim-pol domain [56747] (3 families) (S)
  5. 2215016Family d.264.1.1: PriA-like [56748] (3 protein domains)
    contains additional insert all-alpha subdomain
  6. 2298793Protein automated matches [342094] (1 species)
    not a true protein
  7. 2298794Species Sulfolobus solfataricus [TaxId:273057] [342095] (1 PDB entry)
  8. 2298795Domain d5ofna_: 5ofn A: [342096]
    Other proteins in same PDB: d5ofnb_
    automated match to d1zt2a1
    complexed with zn

Details for d5ofna_

PDB Entry: 5ofn (more details), 3.01 Å

PDB Description: crystal structure of the heterotrimeric prislx primase from s. solfataricus.
PDB Compounds: (A:) DNA primase small subunit PriS

SCOPe Domain Sequences for d5ofna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ofna_ d.264.1.1 (A:) automated matches {Sulfolobus solfataricus [TaxId: 273057]}
tnliksffrnyylnaelelpkdmelrefalqpfgsdtyvrhlsfssseelrdylvnrnlp
lhlfyssaryqlpsarnmeekawmgsdllfdidadhlcklrsirfcpvcgnavvsekcer
dnvetleyvemtsecikrgleqtrnlveileddfglkpkvyfsgnrgfhvqvdcygncal
ldsderkeiaeyvmgigvpgypggsenapgwvgrknrgingvtideqvtidvkrliripn
slhgksglivkrvpnlddfefnetlspftgytiflpyitietevlgsiiklnrgipikik
ssigiylhlrnlgevkayv

SCOPe Domain Coordinates for d5ofna_:

Click to download the PDB-style file with coordinates for d5ofna_.
(The format of our PDB-style files is described here.)

Timeline for d5ofna_:

  • d5ofna_ appears in periodic updates to SCOPe 2.06 starting on 2017-11-30