Lineage for d5lbyb_ (5lby B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2101600Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2102350Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2102504Family c.23.5.3: Quinone reductase [52235] (4 protein domains)
    binds FAD
  6. 2102560Protein Quinone reductase type 2 (menadione reductase) [52240] (1 species)
  7. 2102561Species Human (Homo sapiens) [TaxId:9606] [52241] (66 PDB entries)
  8. 2298791Domain d5lbyb_: 5lby B: [342092]
    automated match to d4fgla_
    complexed with 6t2, fad, zn

Details for d5lbyb_

PDB Entry: 5lby (more details), 1.4 Å

PDB Description: structure of the human quinone reductase 2 (nqo2) in complex with crenolanib
PDB Compounds: (B:) Ribosyldihydronicotinamide dehydrogenase [quinone]

SCOPe Domain Sequences for d5lbyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lbyb_ c.23.5.3 (B:) Quinone reductase type 2 (menadione reductase) {Human (Homo sapiens) [TaxId: 9606]}
gkkvlivyahqepksfngslknvavdelsrqgctvtvsdlyamnlepratdkditgtlsn
pevfnygvetheaykqrslasditdeqkkvreadlvifqfplywfsvpailkgwmdrvlc
qgfafdipgfydsgllqgklallsvttggtaemytktgvngdsryflwplqhgtlhfcgf
kvlapqisfapeiaseeerkgmvaawsqrlqtiwkeepipctahwhfg

SCOPe Domain Coordinates for d5lbyb_:

Click to download the PDB-style file with coordinates for d5lbyb_.
(The format of our PDB-style files is described here.)

Timeline for d5lbyb_:

  • d5lbyb_ appears in periodic updates to SCOPe 2.06 starting on 2017-11-30