Lineage for d5oefb3 (5oef B:210-574)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2147779Fold c.96: Fe-only hydrogenase [53919] (1 superfamily)
    consist of two intertwined domains; contains partial duplication
  4. 2147780Superfamily c.96.1: Fe-only hydrogenase [53920] (1 family) (S)
    automatically mapped to Pfam PF02906
  5. 2147781Family c.96.1.1: Fe-only hydrogenase [53921] (3 protein domains)
  6. 2147792Protein automated matches [279207] (1 species)
    not a true protein
  7. 2147793Species Clostridium pasteurianum [TaxId:1501] [279208] (7 PDB entries)
  8. 2298787Domain d5oefb3: 5oef B:210-574 [342088]
    Other proteins in same PDB: d5oefa1, d5oefa2, d5oefb1, d5oefb2
    automated match to d3c8ya1
    complexed with 9sq, fes, mg, sf4

Details for d5oefb3

PDB Entry: 5oef (more details), 2.05 Å

PDB Description: active semisynthetic [fefe]-hydrogenase cpi with aza-diselenato- bridged [2fe] cofactor
PDB Compounds: (B:) Iron hydrogenase 1

SCOPe Domain Sequences for d5oefb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5oefb3 c.96.1.1 (B:210-574) automated matches {Clostridium pasteurianum [TaxId: 1501]}
hmdrvknalnapekhvivamapsvrasigelfnmgfgvdvtgkiytalrqlgfdkifdin
fgadmtimeeatelvqrienngpfpmftsccpgwvrqaenyypellnnlssakspqqifg
tasktyypsisgldpknvftvtvmpctskkfeadrpqmekdglrdidavittrelakmik
dakipfakledseadpamgeysgagaifgatggvmeaalrsakdfaenaeledieykqvr
glngikeaeveinnnkynvavingasnlfkfmksgminekqyhfievmachggcvngggq
phvnpkdlekvdikkvrasvlynqdehlskrkshentalvkmyqnyfgkpgegraheilh
fkykk

SCOPe Domain Coordinates for d5oefb3:

Click to download the PDB-style file with coordinates for d5oefb3.
(The format of our PDB-style files is described here.)

Timeline for d5oefb3:

  • d5oefb3 appears in periodic updates to SCOPe 2.06 starting on 2017-11-30