SCOPe 2.06: Domain d5m7cb1: 5m7c B:64-354

Lineage for d5m7cb1 (5m7c B:64-354)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest

4. Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families)

5. Family c.68.1.9: alpha-1,3-galactosyltransferase-like [64131] (4 proteins)
   automatically mapped to Pfam PF03414

6. Protein automated matches [190178] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186910] (75 PDB entries)

8. Domain d5m7cb1: 5m7c B:64-354 [342072]
   Other proteins in same PDB: d5m7ca2, d5m7cb2
   automated match to d3zgfa_
   complexed with mn, peg, so4, udp

Details for d5m7cb1

PDB Entry: 5m7c, 1.6 Å

PDB Description: blood group synthase aaglyb in complex with udp and cryoprotected with peg 3350

PDB Compounds: (B:) Histo-blood group ABO system transferase

SCOPe Domain Sequences for d5m7cb1:

Sequence; same for both SEQRES and ATOM records:

>d5m7cb1 c.68.1.9 (B:64-354) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vslprmvypqpkvltpcrkdvlvvtpwlapivwegtfnidilneqfrlqnttigltvfai
kkyvaflklfletaekhfmvghrvhyyvftdqpaavprvtlgtgrqlsvlevraykrwqd
vsmrrmemisdfcerrflsevdylvcvdvdmefrdhvgveiltplfgtlhpgfygssrea
ftyerrpqsqayipkdegdfyyggaffggsvqevqrltrachqammvdqangieavwhde
shlnkyllrhkptkvlspeylwdqqllgwpavlrklrftavpknhqavrnp

Timeline for d5m7cb1:

• d5m7cb1 is new in SCOPe 2.06-stable
  
• d5m7cb1 appears in SCOPe 2.07
  
• d5m7cb1 appears in the current release, SCOPe 2.08