Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily) 8-stranded mixed beta-sheet; 2 layers: alpha/beta |
Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) |
Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins) |
Protein automated matches [190229] (11 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187292] (141 PDB entries) |
Domain d5lo0a_: 5lo0 A: [342063] automated match to d2xjxa_ complexed with 70n |
PDB Entry: 5lo0 (more details), 2.3 Å
SCOPe Domain Sequences for d5lo0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5lo0a_ d.122.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} vetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskldsgkel hinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadismigqfgv gfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedqte yleerrikeivkkhsqfigypitlfve
Timeline for d5lo0a_: