Lineage for d6ekua2 (6eku A:243-372,A:570-805)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2064980Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2064981Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2064982Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 protein domains)
  6. 2065261Protein Vibrio cholerae sialidase [50950] (2 species)
    contains 2 additional domains of ConA-like fold
  7. 2298747Species Vibrio cholerae [TaxId:243277] [342048] (2 PDB entries)
  8. 2298753Domain d6ekua2: 6eku A:243-372,A:570-805 [342054]
    Other proteins in same PDB: d6ekua1, d6ekua3
    automated match to d1kita3
    complexed with ca, gol, na, peg, zmr

Details for d6ekua2

PDB Entry: 6eku (more details), 1.75 Å

PDB Description: vibrio cholerae neuraminidase complexed with zanamivir
PDB Compounds: (A:) sialidase

SCOPe Domain Sequences for d6ekua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ekua2 b.68.1.1 (A:243-372,A:570-805) Vibrio cholerae sialidase {Vibrio cholerae [TaxId: 243277]}
vifrgpdripsivassvtpgvvtafaekrvgggdpgalsntndiitrtsrdggitwdtel
nlteqinvsdefdfsdprpiydpssntvlvsyarwptdaaqngdrikpwmpngifysvyd
vasgnwqapiXvnpgpghgitltrqqnisgsqngrliypaivldrfflnvmsiysddggs
nwqtgstlpipfrwksssiletlepseadmvelqngdllltarldfnqivngvnysprqq
flskdggitwslleannanvfsnistgtvdasitrfeqsdgshfllftnpqgnpagtngr
qnlglwfsfdegvtwkgpiqlvngasaysdiyqldsenaivivetdnsnmrilrmpitll
kqkltls

SCOPe Domain Coordinates for d6ekua2:

Click to download the PDB-style file with coordinates for d6ekua2.
(The format of our PDB-style files is described here.)

Timeline for d6ekua2:

  • d6ekua2 appears in periodic updates to SCOPe 2.06 starting on 2017-11-30