Lineage for d6ekua1 (6eku A:51-242)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2043544Family b.29.1.8: Vibrio cholerae sialidase, N-terminal and insertion domains [49965] (1 protein)
  6. 2043545Protein Vibrio cholerae sialidase, N-terminal and insertion domains [49966] (2 species)
    both domains have this fold
    rest of protein is beta-propeller of six sheets
  7. 2298745Species Vibrio cholerae [TaxId:243277] [342046] (2 PDB entries)
  8. 2298752Domain d6ekua1: 6eku A:51-242 [342053]
    Other proteins in same PDB: d6ekua2
    automated match to d1kita1
    complexed with ca, gol, na, peg, zmr

Details for d6ekua1

PDB Entry: 6eku (more details), 1.75 Å

PDB Description: vibrio cholerae neuraminidase complexed with zanamivir
PDB Compounds: (A:) sialidase

SCOPe Domain Sequences for d6ekua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ekua1 b.29.1.8 (A:51-242) Vibrio cholerae sialidase, N-terminal and insertion domains {Vibrio cholerae [TaxId: 243277]}
alfdynatgdtefdspakqgwmqdntnngsgvltnadgmpawlvqgiggraqwtyslstn
qhaqassfgwrmttemkvlsggmitnyyangtqrvlpiisldssgnlvvefegqtgrtvl
atgtaateyhkfelvflpgsnpsasfyfdgklirdniqptaskqnmivwgngssntdgva
ayrdikfeiqgd

SCOPe Domain Coordinates for d6ekua1:

Click to download the PDB-style file with coordinates for d6ekua1.
(The format of our PDB-style files is described here.)

Timeline for d6ekua1:

  • d6ekua1 appears in periodic updates to SCOPe 2.06 starting on 2017-11-30