Lineage for d6eksa2 (6eks A:243-372,A:570-802)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2064980Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2064981Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2064982Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 protein domains)
  6. 2065261Protein Vibrio cholerae sialidase [50950] (2 species)
    contains 2 additional domains of ConA-like fold
  7. 2298747Species Vibrio cholerae [TaxId:243277] [342048] (2 PDB entries)
  8. 2298748Domain d6eksa2: 6eks A:243-372,A:570-802 [342049]
    Other proteins in same PDB: d6eksa1, d6eksa3
    automated match to d1kita3
    complexed with ca, g39, gol

Details for d6eksa2

PDB Entry: 6eks (more details), 1.87 Å

PDB Description: vibrio cholerae neuraminidase complexed with oseltamivir carboxylate
PDB Compounds: (A:) sialidase

SCOPe Domain Sequences for d6eksa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6eksa2 b.68.1.1 (A:243-372,A:570-802) Vibrio cholerae sialidase {Vibrio cholerae [TaxId: 243277]}
vifrgpdripsivassvtpgvvtafaekrvgggdpgalsntndiitrtsrdggitwdtel
nlteqinvsdefdfsdprpiydpssntvlvsyarwptdaaqngdrikpwmpngifysvyd
vasgnwqapiXvnpgpghgitltrqqnisgsqngrliypaivldrfflnvmsiysddggs
nwqtgstlpipfrwksssiletlepseadmvelqngdllltarldfnqivngvnysprqq
flskdggitwslleannanvfsnistgtvdasitrfeqsdgshfllftnpqgnpagtngr
qnlglwfsfdegvtwkgpiqlvngasaysdiyqldsenaivivetdnsnmrilrmpitll
kqkl

SCOPe Domain Coordinates for d6eksa2:

Click to download the PDB-style file with coordinates for d6eksa2.
(The format of our PDB-style files is described here.)

Timeline for d6eksa2:

  • d6eksa2 appears in periodic updates to SCOPe 2.06 starting on 2017-11-30