Lineage for d6babc_ (6bab C:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2195565Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2195566Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2199100Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2199101Protein automated matches [190417] (25 species)
    not a true protein
  7. 2200201Species Mouse (Mus musculus) [TaxId:10090] [194605] (24 PDB entries)
  8. 2298736Domain d6babc_: 6bab C: [342036]
    automated match to d2vn9a_
    complexed with d0s, tla

Details for d6babc_

PDB Entry: 6bab (more details), 1.91 Å

PDB Description: the structure of human camkii with bound inhibitor
PDB Compounds: (C:) Calcium/calmodulin-dependent protein kinase type II subunit delta

SCOPe Domain Sequences for d6babc_:

Sequence, based on SEQRES records: (download)

>d6babc_ d.144.1.0 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
eyqlfeelgkgafsvvrrcmkiptgqeyaakiintkklsardhqklerearicrllkhpn
ivrlhdsiseegfhylvfdlvtggelfedivareyyseadashciqqilesvnhchlngi
vhrdlkpenlllaskskgaavkladfglaievqgdqqawfgfagtpgylspevlrkdpyg
kpvdmwacgvilyillvgyppfwdedqhrlyqqikagaydfpspewdtvtpeakdlinkm
ltinpakritasealkhpwicqrstvasmmhrqetvdclkkfnarrkl

Sequence, based on observed residues (ATOM records): (download)

>d6babc_ d.144.1.0 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
eyqlfeelgkgafsvvrrcmkqeyaakiintkklsardhqklerearicrllkhpnivrl
hdsiseegfhylvfdlvtggelfedivareyyseadashciqqilesvnhchlngivhrd
lkpenlllaskskgaavkladfglaievqgdqqawfgfagtpgylspevlrkdpygkpvd
mwacgvilyillvgyppfwdedqhrlyqqikagaydfpspewdtvtpeakdlinkmltin
pakritasealkhpwicqrstvasmmhrqetvdclkkfnarrkl

SCOPe Domain Coordinates for d6babc_:

Click to download the PDB-style file with coordinates for d6babc_.
(The format of our PDB-style files is described here.)

Timeline for d6babc_:

  • d6babc_ appears in periodic updates to SCOPe 2.06 starting on 2017-11-30