Lineage for d6blea1 (6ble A:161-448)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2546221Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2546222Protein automated matches [190417] (28 species)
    not a true protein
  7. 2546365Species Human (Homo sapiens) [TaxId:9606] [187294] (1001 PDB entries)
  8. 2546832Domain d6blea1: 6ble A:161-448 [342034]
    Other proteins in same PDB: d6blea2
    automated match to d2zv2a_
    complexed with 34u, gol

Details for d6blea1

PDB Entry: 6ble (more details), 1.9 Å

PDB Description: crystal structure of the human camkk2b in complex with cp673451
PDB Compounds: (A:) Calcium/calmodulin-dependent protein kinase kinase 2

SCOPe Domain Sequences for d6blea1:

Sequence, based on SEQRES records: (download)

>d6blea1 d.144.1.0 (A:161-448) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qlnqytlkdeigkgsygvvklaynendntyyamkvlskkklirqagfprrppprgtrpap
ggciqprgpieqvyqeiailkkldhpnvvklvevlddpnedhlymvfelvnqgpvmevpt
lkplsedqarfyfqdlikgieylhyqkiihrdikpsnllvgedghikiadfgvsnefkgs
dallsntvgtpafmapeslsetrkifsgkaldvwamgvtlycfvfgqcpfmderimclhs
kiksqalefpdqpdiaedlkdlitrmldknpesrivvpeiklhpwvtr

Sequence, based on observed residues (ATOM records): (download)

>d6blea1 d.144.1.0 (A:161-448) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qlnqytlkdeigkgsygvvklaynendntyyamkvlskkklirqieqvyqeiailkkldh
pnvvklvevlddpnedhlymvfelvnqgpvmevptlkplsedqarfyfqdlikgieylhy
qkiihrdikpsnllvgedghikiadfgvsnefkgsdallsntvgtpafmapeslsetrki
fsgkaldvwamgvtlycfvfgqcpfmderimclhskiksqalefpdqpdiaedlkdlitr
mldknpesrivvpeiklhpwvtr

SCOPe Domain Coordinates for d6blea1:

Click to download the PDB-style file with coordinates for d6blea1.
(The format of our PDB-style files is described here.)

Timeline for d6blea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6blea2