Class a: All alpha proteins [46456] (290 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein Myoglobin [46469] (11 species) |
Species Kogia sima [TaxId:9752] [342029] (1 PDB entry) |
Domain d6bmgb_: 6bmg B: [342032] automated match to d4pnja_ complexed with act, cd, hem, oxy |
PDB Entry: 6bmg (more details), 1.88 Å
SCOPe Domain Sequences for d6bmgb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6bmgb_ a.1.1.2 (B:) Myoglobin {Kogia sima [TaxId: 9752]} mvlsegewqlvlhvwakveadiaghgqdilirlfkhhpetlekfdrfkhlkseaemkase dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh padfgadaqgamskalelfrkdiaakykelgyqg
Timeline for d6bmgb_: