Lineage for d6bmgb_ (6bmg B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2687850Protein Myoglobin [46469] (11 species)
  7. 2687972Species Kogia sima [TaxId:9752] [342029] (1 PDB entry)
  8. 2687974Domain d6bmgb_: 6bmg B: [342032]
    automated match to d4pnja_
    complexed with act, cd, hem, oxy

Details for d6bmgb_

PDB Entry: 6bmg (more details), 1.88 Å

PDB Description: structure of recombinant dwarf sperm whale myoglobin (oxy)
PDB Compounds: (B:) Myoglobin

SCOPe Domain Sequences for d6bmgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bmgb_ a.1.1.2 (B:) Myoglobin {Kogia sima [TaxId: 9752]}
mvlsegewqlvlhvwakveadiaghgqdilirlfkhhpetlekfdrfkhlkseaemkase
dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
padfgadaqgamskalelfrkdiaakykelgyqg

SCOPe Domain Coordinates for d6bmgb_:

Click to download the PDB-style file with coordinates for d6bmgb_.
(The format of our PDB-style files is described here.)

Timeline for d6bmgb_: