Lineage for d6bmab1 (6bma B:1-258)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2079053Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2079793Family c.1.2.0: automated matches [191350] (1 protein)
    not a true family
  6. 2079794Protein automated matches [190292] (34 species)
    not a true protein
  7. 2079824Species Campylobacter jejuni [TaxId:192222] [194783] (4 PDB entries)
  8. 2298727Domain d6bmab1: 6bma B:1-258 [342028]
    Other proteins in same PDB: d6bmaa2, d6bmab2
    automated match to d3tsma_
    complexed with act, cl, edo, fmt, k, po4

Details for d6bmab1

PDB Entry: 6bma (more details), 1.98 Å

PDB Description: the crystal structure of indole-3-glycerol phosphate synthase from campylobacter jejuni subsp. jejuni nctc 11168
PDB Compounds: (B:) indole-3-glycerol phosphate synthase

SCOPe Domain Sequences for d6bmab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bmab1 c.1.2.0 (B:1-258) automated matches {Campylobacter jejuni [TaxId: 192222]}
mildkifektkedlkerklklpydmlgrslasnpffpkdvikalkrvekevkiiaevkka
spskgviredfdplsialnyeknkaaaisvltephffkgsleylslirrytqipllrkdf
ifdeyqilealvygadfvlliakmlsmkelkkllefarhlglealveihdkedlskaifa
gadiiginhrnledftmdmslceklipqipnskiiiaesglenkeflehlqnlgvdafli
geyfmrekdegkalkall

SCOPe Domain Coordinates for d6bmab1:

Click to download the PDB-style file with coordinates for d6bmab1.
(The format of our PDB-style files is described here.)

Timeline for d6bmab1:

  • d6bmab1 appears in periodic updates to SCOPe 2.06 starting on 2017-11-30

View in 3D
Domains from same chain:
(mouse over for more information)
d6bmab2