Lineage for d6alzb1 (6alz B:7-299)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2206306Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 2206307Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 2206385Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 protein domains)
  6. 2206411Protein Protein phosphatase-1 (PP-1) [56311] (5 species)
  7. 2206433Species Human (Homo sapiens), gamma isoform [TaxId:9606] [111230] (5 PDB entries)
    Uniprot P37140 1-308
  8. 2298722Domain d6alzb1: 6alz B:7-299 [342024]
    Other proteins in same PDB: d6alzb2
    automated match to d1s70a_
    complexed with bkm, cl, dms, mn

Details for d6alzb1

PDB Entry: 6alz (more details), 2.21 Å

PDB Description: crystal structure of protein phosphatase 1 bound to the natural inhibitor tautomycetin
PDB Compounds: (B:) Serine/threonine-protein phosphatase PP1-alpha catalytic subunit

SCOPe Domain Sequences for d6alzb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6alzb1 d.159.1.3 (B:7-299) Protein phosphatase-1 (PP-1) {Human (Homo sapiens), gamma isoform [TaxId: 9606]}
lnldsiigrllevqgsrpgknvqlteneirglclksreiflsqpilleleaplkicgdih
gqyydllrlfeyggfppesnylflgdyvdrgkqsleticlllaykikypenffllrgnhe
casinriygfydeckrryniklwktftdcfnclpiaaivdekifcchgglspdlqsmeqi
rrimrptdvpdqgllcdllwsdpdkdvqgwgendrgvsftfgaevvakflhkhdldlicr
ahqvvedgyeffakrqlvtlfsapnycgefdnagammsvdetlmcsfqilkpa

SCOPe Domain Coordinates for d6alzb1:

Click to download the PDB-style file with coordinates for d6alzb1.
(The format of our PDB-style files is described here.)

Timeline for d6alzb1:

  • d6alzb1 appears in periodic updates to SCOPe 2.06 starting on 2017-11-30

View in 3D
Domains from same chain:
(mouse over for more information)
d6alzb2
View in 3D
Domains from other chains:
(mouse over for more information)
d6alza_