Lineage for d1dl5b_ (1dl5 B:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 72963Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
  4. 72964Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (13 families) (S)
  5. 73008Family c.66.1.7: Protein-L-isoaspartate O-methyltransferase [53354] (1 protein)
  6. 73009Protein Protein-L-isoaspartate O-methyltransferase [53355] (1 species)
  7. 73010Species Thermotoga maritima [TaxId:243274] [53356] (1 PDB entry)
  8. 73012Domain d1dl5b_: 1dl5 B: [34202]

Details for d1dl5b_

PDB Entry: 1dl5 (more details), 1.8 Å

PDB Description: protein-l-isoaspartate o-methyltransferase

SCOP Domain Sequences for d1dl5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dl5b_ c.66.1.7 (B:) Protein-L-isoaspartate O-methyltransferase {Thermotoga maritima}
mreklfwilkkygvsdhiakafleipreefltksyplsyvyedivlvsyddgeeystssq
pslmalfmewvgldkgmrvleigggtgynaavmsrvvgekglvvsveysrkiceiakrnv
erlgienvifvcgdgyygvpefspydvifvtvgvdevpetwftqlkeggrvivpinlkls
rrqpaflfkkkdpylvgnykletrfitaggnlgnllernrkllrefpfnreillvrshif
velvdlltrrlteidgtfyyagpngvveflddrmriygdapeienlltqwescgyrsfey
lmlhvgynafshiscs

SCOP Domain Coordinates for d1dl5b_:

Click to download the PDB-style file with coordinates for d1dl5b_.
(The format of our PDB-style files is described here.)

Timeline for d1dl5b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1dl5a_