Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
Family d.58.4.0: automated matches [191316] (1 protein) not a true family |
Protein automated matches [190081] (33 species) not a true protein |
Species Passiflora edulis [TaxId:78168] [341952] (3 PDB entries) |
Domain d5y02i_: 5y02 I: [342019] Other proteins in same PDB: d5y02c2 automated match to d1tr0a_ complexed with hbx, hez, mxn; mutant |
PDB Entry: 5y02 (more details), 1.8 Å
SCOPe Domain Sequences for d5y02i_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5y02i_ d.58.4.0 (I:) automated matches {Passiflora edulis [TaxId: 78168]} ppeivrhivfnryksqlsqkqidqiiadygnlqniapemkewkwgtdlgpavedradgft hayestfhsvadflnffysppalefakeffpacekivvlnyiine
Timeline for d5y02i_: