SCOPe 2.06: Domain d5xlzb1: 5xlz B:2-243

Lineage for d5xlzb1 (5xlz B:2-243)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families)
   automatically mapped to Pfam PF00091

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)

6. Protein automated matches [226837] (7 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [226564] (48 PDB entries)

8. Domain d5xlzb1: 5xlz B:2-243 [342012]
   Other proteins in same PDB: d5xlza2, d5xlzb2, d5xlzc2, d5xlzd2, d5xlze_, d5xlzf1, d5xlzf2, d5xlzf3
   automated match to d4drxb1
   complexed with 89u, acp, ca, gdp, gtp, mes, mg

Details for d5xlzb1

PDB Entry: 5xlz, 2.3 Å

PDB Description: the crystal structure of tubulin complexed with a benzylidene derivative of 9(10h)-anthracenone

PDB Compounds: (B:) Tubulin beta-2B chain

SCOPe Domain Sequences for d5xlzb1:

Sequence; same for both SEQRES and ATOM records:

>d5xlzb1 c.32.1.1 (B:2-243) automated matches {Cow (Bos taurus) [TaxId: 9913]}
reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyvp
railvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvr
kesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvve
pynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttclr
fp

Timeline for d5xlzb1:

• d5xlzb1 is new in SCOPe 2.06-stable
  
• d5xlzb1 appears in SCOPe 2.07
  
• d5xlzb1 appears in the current release, SCOPe 2.08