Lineage for d5y02c1 (5y02 C:1-106)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2172288Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2172847Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 2173213Family d.58.4.0: automated matches [191316] (1 protein)
    not a true family
  6. 2173214Protein automated matches [190081] (27 species)
    not a true protein
  7. 2298651Species Passiflora edulis [TaxId:78168] [341952] (3 PDB entries)
  8. 2298704Domain d5y02c1: 5y02 C:1-106 [342005]
    Other proteins in same PDB: d5y02c2
    automated match to d1tr0a_
    complexed with hbx, hez, mxn; mutant

Details for d5y02c1

PDB Entry: 5y02 (more details), 1.8 Å

PDB Description: c-terminal peptide depleted mutant of hydroxynitrile lyase from passiflora edulis (pehnl) bound with (r)-mandelonitrile
PDB Compounds: (C:) hydroxynitrile lyase

SCOPe Domain Sequences for d5y02c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5y02c1 d.58.4.0 (C:1-106) automated matches {Passiflora edulis [TaxId: 78168]}
nppeivrhivfnryksqlsqkqidqiiadygnlqniapemkewkwgtdlgpavedradgf
thayestfhsvadflnffysppalefakeffpacekivvlnyiine

SCOPe Domain Coordinates for d5y02c1:

Click to download the PDB-style file with coordinates for d5y02c1.
(The format of our PDB-style files is described here.)

Timeline for d5y02c1:

  • d5y02c1 appears in periodic updates to SCOPe 2.06 starting on 2017-11-24