Lineage for d5ypqh_ (5ypq H:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2101600Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2103506Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (2 families) (S)
  5. 2103507Family c.23.13.1: Type II 3-dehydroquinate dehydratase [52305] (2 protein domains)
    automatically mapped to Pfam PF01220
  6. 2103621Protein automated matches [190071] (5 species)
    not a true protein
  7. 2103622Species Acinetobacter baumannii [TaxId:400667] [260436] (4 PDB entries)
  8. 2298697Domain d5ypqh_: 5ypq H: [341998]
    automated match to d4rhca_
    complexed with gol, so4

Details for d5ypqh_

PDB Entry: 5ypq (more details), 2.65 Å

PDB Description: crystal structure of sulfated dehydroquinate dehydratase from acinetobacter baumannii at 2.65 a resolution
PDB Compounds: (H:) 3-dehydroquinate dehydratase

SCOPe Domain Sequences for d5ypqh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ypqh_ c.23.13.1 (H:) automated matches {Acinetobacter baumannii [TaxId: 400667]}
stilvihgpnlnllgkrepevyghltldninrqliaqaeqasitldtfqsnwegaivdri
hqaqtegvkliiinpaalthtsvalrdallgvaipfievhlsnvhareafrhhsylsdka
igvicglgakgysfaldyaiekiqp

SCOPe Domain Coordinates for d5ypqh_:

Click to download the PDB-style file with coordinates for d5ypqh_.
(The format of our PDB-style files is described here.)

Timeline for d5ypqh_:

  • d5ypqh_ appears in periodic updates to SCOPe 2.06 starting on 2017-11-24