Lineage for d5ym7a_ (5ym7 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1987359Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 1987402Superfamily a.24.3: Cytochromes [47175] (3 families) (S)
    Heme-containing proteins
  5. 1987403Family a.24.3.1: Cytochrome b562 [47176] (2 protein domains)
    automatically mapped to Pfam PF07361
  6. 1987404Protein Cytochrome b562 [47177] (1 species)
  7. 1987405Species Escherichia coli [TaxId:562] [47178] (7 PDB entries)
  8. 2298689Domain d5ym7a_: 5ym7 A: [341990]
    automated match to d1m6ta_

Details for d5ym7a_

PDB Entry: 5ym7 (more details), 1.56 Å

PDB Description: crystal structure of b562ril without disulfide bond
PDB Compounds: (A:) Soluble cytochrome b562

SCOPe Domain Sequences for d5ym7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ym7a_ a.24.3.1 (A:) Cytochrome b562 {Escherichia coli [TaxId: 562]}
adlednwetlndnlkviekadnaaqvkdaltkmraaaldaqkatppkledkspdspemkd
frhgfdilvgqiddalklanegkvkeaqaaaeqlkttrnayiqkyl

SCOPe Domain Coordinates for d5ym7a_:

Click to download the PDB-style file with coordinates for d5ym7a_.
(The format of our PDB-style files is described here.)

Timeline for d5ym7a_:

  • d5ym7a_ appears in periodic updates to SCOPe 2.06 starting on 2017-11-24