Lineage for d5y15b_ (5y15 B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2454571Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 2454572Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 2455001Family c.45.1.0: automated matches [191381] (1 protein)
    not a true family
  6. 2455002Protein automated matches [190475] (9 species)
    not a true protein
  7. 2455014Species Human (Homo sapiens) [TaxId:9606] [187400] (121 PDB entries)
  8. 2455138Domain d5y15b_: 5y15 B: [341987]
    automated match to d2wgpb_
    complexed with po4

Details for d5y15b_

PDB Entry: 5y15 (more details), 2.1 Å

PDB Description: crystal structure of human dusp28
PDB Compounds: (B:) Dual specificity phosphatase 28

SCOPe Domain Sequences for d5y15b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5y15b_ c.45.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lvrvapslflgsaraagaeeqlaragvtlcvnvsrqqpgpqapgvaelrvpvfddpaedl
lahleptcaameaavraggaclvyskngrsrsaavctaylmrhrglslakafqmvksarp
vaepnpgfwsqlqkyeealqaqs

SCOPe Domain Coordinates for d5y15b_:

Click to download the PDB-style file with coordinates for d5y15b_.
(The format of our PDB-style files is described here.)

Timeline for d5y15b_: