Lineage for d5xzqf_ (5xzq F:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2516578Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2517142Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 2517516Family d.58.4.0: automated matches [191316] (1 protein)
    not a true family
  6. 2517517Protein automated matches [190081] (28 species)
    not a true protein
  7. 2517672Species Passiflora edulis [TaxId:78168] [341952] (3 PDB entries)
  8. 2517702Domain d5xzqf_: 5xzq F: [341967]
    automated match to d1tr0a_

Details for d5xzqf_

PDB Entry: 5xzq (more details), 2.8 Å

PDB Description: hydroxynitrile lyase from passiflora edulis (pehnl)
PDB Compounds: (F:) hydroxynitrile lyase

SCOPe Domain Sequences for d5xzqf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xzqf_ d.58.4.0 (F:) automated matches {Passiflora edulis [TaxId: 78168]}
eivrhivfnryksqlsqkqidqiiadygnlqniapemkewkwgtdlgpavedradgftha
yestfhsvadflnffysppalefakeffpacekivvlnyiine

SCOPe Domain Coordinates for d5xzqf_:

Click to download the PDB-style file with coordinates for d5xzqf_.
(The format of our PDB-style files is described here.)

Timeline for d5xzqf_: