Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) |
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
Protein automated matches [227071] (5 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [226565] (48 PDB entries) |
Domain d5xlzd2: 5xlz D:244-431 [341955] Other proteins in same PDB: d5xlza1, d5xlzb1, d5xlzc1, d5xlzd1, d5xlze_, d5xlzf1, d5xlzf2, d5xlzf3 automated match to d3rycd2 complexed with 89u, acp, ca, gdp, gtp, mes, mg |
PDB Entry: 5xlz (more details), 2.3 Å
SCOPe Domain Sequences for d5xlzd2:
Sequence, based on SEQRES records: (download)
>d5xlzd2 d.79.2.1 (D:244-431) automated matches {Cow (Bos taurus) [TaxId: 9913]} gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq qyqdatad
>d5xlzd2 d.79.2.1 (D:244-431) automated matches {Cow (Bos taurus) [TaxId: 9913]} gqlnadlrklavnmvpfprlhffmpgfaplltvpeltqqmfdsknmmaacdprhgryltv aaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkmsatfignsta iqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyqqyqdatad
Timeline for d5xlzd2: