Lineage for d5xlzd1 (5xlz D:1-243)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2107739Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2107740Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2107741Family c.32.1.1: Tubulin, GTPase domain [52491] (4 protein domains)
  6. 2107851Protein automated matches [226837] (7 species)
    not a true protein
  7. 2107855Species Cow (Bos taurus) [TaxId:9913] [226564] (45 PDB entries)
  8. 2298653Domain d5xlzd1: 5xlz D:1-243 [341954]
    Other proteins in same PDB: d5xlza2, d5xlzb2, d5xlzc2, d5xlzd2, d5xlze_, d5xlzf1, d5xlzf2, d5xlzf3
    automated match to d4drxb1
    complexed with 89u, acp, ca, gdp, gtp, mes, mg

Details for d5xlzd1

PDB Entry: 5xlz (more details), 2.3 Å

PDB Description: the crystal structure of tubulin complexed with a benzylidene derivative of 9(10h)-anthracenone
PDB Compounds: (D:) Tubulin beta-2B chain

SCOPe Domain Sequences for d5xlzd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xlzd1 c.32.1.1 (D:1-243) automated matches {Cow (Bos taurus) [TaxId: 9913]}
mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyv
prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvv
epynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttcl
rfp

SCOPe Domain Coordinates for d5xlzd1:

Click to download the PDB-style file with coordinates for d5xlzd1.
(The format of our PDB-style files is described here.)

Timeline for d5xlzd1:

  • d5xlzd1 appears in periodic updates to SCOPe 2.06 starting on 2017-11-24