Lineage for d5wyob_ (5wyo B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1998575Fold a.57: Protein HNS-dependent expression A; HdeA [47751] (1 superfamily)
    4 helices; the three last helices form a bundle similar to that of the RuvA C-domain
  4. 1998576Superfamily a.57.1: Protein HNS-dependent expression A; HdeA [47752] (1 family) (S)
    overall fold is similar to the fold of N-terminal subdomain of the GluRS anticodon-binding domain (1GLN)
    automatically mapped to Pfam PF06411
  5. 1998577Family a.57.1.1: Protein HNS-dependent expression A; HdeA [47753] (2 protein domains)
  6. 2298644Protein automated matches [341945] (1 species)
    not a true protein
  7. 2298645Species Escherichia coli [TaxId:83334] [341946] (1 PDB entry)
  8. 2298649Domain d5wyob_: 5wyo B: [341950]
    automated match to d1dj8a_

Details for d5wyob_

PDB Entry: 5wyo (more details)

PDB Description: solution structure of e.coli hdea
PDB Compounds: (B:) Acid stress chaperone HdeA

SCOPe Domain Sequences for d5wyob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wyob_ a.57.1.1 (B:) automated matches {Escherichia coli [TaxId: 83334]}
adaqkaadnkkpvnswtcedflavdesfqptavgfaealnnkdkpedavldvqgiatvtp
aivqactqdkqanfkdkvkgewdkikkdm

SCOPe Domain Coordinates for d5wyob_:

Click to download the PDB-style file with coordinates for d5wyob_.
(The format of our PDB-style files is described here.)

Timeline for d5wyob_:

  • d5wyob_ appears in periodic updates to SCOPe 2.06 starting on 2017-11-24

View in 3D
Domains from other chains:
(mouse over for more information)
d5wyoa_