Lineage for d1d2hd_ (1d2h D:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 26076Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
  4. 26077Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (11 families) (S)
  5. 26095Family c.66.1.5: Glycine N-methyltransferase [53348] (1 protein)
  6. 26096Protein Glycine N-methyltransferase [53349] (1 species)
  7. 26097Species Rat (Rattus norvegicus) [TaxId:10116] [53350] (5 PDB entries)
  8. 26109Domain d1d2hd_: 1d2h D: [34194]

Details for d1d2hd_

PDB Entry: 1d2h (more details), 3 Å

PDB Description: crystal structure of r175k mutant glycine n-methyltransferase complexed with s-adenosylhomocysteine

SCOP Domain Sequences for d1d2hd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d2hd_ c.66.1.5 (D:) Glycine N-methyltransferase {Rat (Rattus norvegicus)}
taeykawllgllrqhgchrvldvacgtgvdsimlveegfsvtsvdasdkmlkyalkerwn
rrkepafdkwvieeanwltldkdvpagdgfdaviclgnsfahlpdskgdqsehrlalkni
asmvrpggllvidhknydyilstgcappgkniyyksdltkdittsvltvnnkahmvtldy
tvqvpgagrdgapgfskfrlsyyphclasftelvqeafggrcqhsvlgdfkpyrpgqayv
pcyfihvlkktg

SCOP Domain Coordinates for d1d2hd_:

Click to download the PDB-style file with coordinates for d1d2hd_.
(The format of our PDB-style files is described here.)

Timeline for d1d2hd_: