Lineage for d5wqlb_ (5wql B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2007336Superfamily a.118.8: TPR-like [48452] (9 families) (S)
  5. 2007337Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (20 protein domains)
  6. 2007368Protein Lipoprotein NlpI [117009] (2 species)
  7. 2298624Species Escherichia coli [TaxId:83333] [341925] (1 PDB entry)
  8. 2298636Domain d5wqlb_: 5wql B: [341937]
    Other proteins in same PDB: d5wqla2
    automated match to d1xnfb_

Details for d5wqlb_

PDB Entry: 5wql (more details), 2.3 Å

PDB Description: structure of a pdz-protease bound to a substrate-binding adaptor
PDB Compounds: (B:) Lipoprotein nlpI

SCOPe Domain Sequences for d5wqlb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wqlb_ a.118.8.1 (B:) Lipoprotein NlpI {Escherichia coli [TaxId: 83333]}
ntswrksevlavplqptlqqevilarmeqilasraltdderaqllyergvlydslglral
arndfsqalairpdmpevfnylgiyltqagnfdaayeafdsvleldptynyahlnrgial
yyggrdklaqddllafyqddpndpfrslwlylaeqkldekqakevlkqhfeksdkeqwgw
nivefylgniseqtlmerlkadatdntslaehlsetnfylgkyylslgdldsatalfkla
vannvhnfvehryallelsllgqdqddl

SCOPe Domain Coordinates for d5wqlb_:

Click to download the PDB-style file with coordinates for d5wqlb_.
(The format of our PDB-style files is described here.)

Timeline for d5wqlb_:

  • d5wqlb_ appears in periodic updates to SCOPe 2.06 starting on 2017-11-24