Lineage for d5wbba1 (5wbb A:14-134)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2063610Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2063611Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 2063612Family b.61.1.1: Avidin/streptavidin [50877] (3 protein domains)
  6. 2063930Protein automated matches [190191] (2 species)
    not a true protein
  7. 2064009Species Streptomyces avidinii [TaxId:1895] [189343] (50 PDB entries)
  8. 2298619Domain d5wbba1: 5wbb A:14-134 [341920]
    Other proteins in same PDB: d5wbba2
    automated match to d2bc3b_
    complexed with cu, gol, so4, sq1

Details for d5wbba1

PDB Entry: 5wbb (more details), 1.5 Å

PDB Description: peroxide activation regulated by hydrogen bonds within artificial cu proteins - s112a
PDB Compounds: (A:) streptavidin

SCOPe Domain Sequences for d5wbba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wbba1 b.61.1.1 (A:14-134) automated matches {Streptomyces avidinii [TaxId: 1895]}
eagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtal
gwtvawknnyrnahsattwsgqyvggaearintqwlltagtteanawkstlvghdtftkv
k

SCOPe Domain Coordinates for d5wbba1:

Click to download the PDB-style file with coordinates for d5wbba1.
(The format of our PDB-style files is described here.)

Timeline for d5wbba1:

  • d5wbba1 appears in periodic updates to SCOPe 2.06 starting on 2017-11-24

View in 3D
Domains from same chain:
(mouse over for more information)
d5wbba2