Lineage for d3w8na_ (3w8n A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (130 species)
    not a true protein
  7. 2114798Species Thermus thermophilus HB8 [TaxId:300852] [189850] (10 PDB entries)
  8. 2298612Domain d3w8na_: 3w8n A: [341913]
    automated match to d3akea_
    complexed with c5p

Details for d3w8na_

PDB Entry: 3w8n (more details), 2.2 Å

PDB Description: open form structure of cmp kinase in complex with cmp from thermus thermophilus hb8
PDB Compounds: (A:) Cytidylate kinase

SCOPe Domain Sequences for d3w8na_:

Sequence, based on SEQRES records: (download)

>d3w8na_ c.37.1.0 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
givtidgpsasgkssvarrvaaalgvpylssgllyraaaflalragvdpgdeegllalle
glgvrllaqaegnrvladgedltsflhtpevdrvvsavarlpgvrawvnrrlkevpppfv
aegrdmgtavfpeaahkfyltaspevrawrrarerpqayeevlrdllrrderdkaqsapa
pdalvldtggmtldevvawvlahi

Sequence, based on observed residues (ATOM records): (download)

>d3w8na_ c.37.1.0 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
givtidgpsasgkssvarrvaaalgvpylssgllyraaaflalragvdpgdeegllalle
glgvrllaqaegnrvladgedltsflhtpevdrvvsavarlpgvrawvnrrlkevpppfv
aegrdmgtavfpeaahkfyltaspevrawrrapqayeevlrdllrrderdkaqsapapda
lvldtggmtldevvawvlahi

SCOPe Domain Coordinates for d3w8na_:

Click to download the PDB-style file with coordinates for d3w8na_.
(The format of our PDB-style files is described here.)

Timeline for d3w8na_:

  • d3w8na_ appears in periodic updates to SCOPe 2.06 starting on 2017-11-24