Lineage for d5ur7b_ (5ur7 B:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2156493Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. 2156494Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) (S)
    form dimers with different dimerisation modes
  5. 2156495Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 protein domains)
  6. 2156783Protein automated matches [190403] (3 species)
    not a true protein
  7. 2156784Species Human (Homo sapiens) [TaxId:9606] [187277] (22 PDB entries)
  8. 2298608Domain d5ur7b_: 5ur7 B: [341909]
    automated match to d1ha6a_
    complexed with act, ipa

Details for d5ur7b_

PDB Entry: 5ur7 (more details), 2 Å

PDB Description: crystal structure of engineered ccl20 disulfide locked dimer
PDB Compounds: (B:) C-C motif chemokine 20

SCOPe Domain Sequences for d5ur7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ur7b_ d.9.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dcclgytdrilhpkfivgftrqlanegcdinaiifhtkkklsvcanpkqtwvkyivrllc
kkvknm

SCOPe Domain Coordinates for d5ur7b_:

Click to download the PDB-style file with coordinates for d5ur7b_.
(The format of our PDB-style files is described here.)

Timeline for d5ur7b_:

  • d5ur7b_ appears in periodic updates to SCOPe 2.06 starting on 2017-11-24