Lineage for d5uipb1 (5uip B:2-159)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2477518Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2477519Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2477974Family c.71.1.0: automated matches [191485] (1 protein)
    not a true family
  6. 2477975Protein automated matches [190777] (22 species)
    not a true protein
  7. 2478120Species Escherichia coli [TaxId:562] [267778] (4 PDB entries)
  8. 2478122Domain d5uipb1: 5uip B:2-159 [341906]
    Other proteins in same PDB: d5uipa2, d5uipb2
    automated match to d2w9ta_
    complexed with 8dm, lg3, na, nap

Details for d5uipb1

PDB Entry: 5uip (more details), 1.9 Å

PDB Description: structure of dhfr with bound dap, p-abg and nadp
PDB Compounds: (B:) dihydrofolate reductase

SCOPe Domain Sequences for d5uipb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5uipb1 c.71.1.0 (B:2-159) automated matches {Escherichia coli [TaxId: 562]}
isliaalavdrvigmenampwnlpadlawfkrntlnkpvimgrhtwesigrplpgrknii
lssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaeveg
dthfpdyepddwesvfsefhdadaqnshsysfeilerr

SCOPe Domain Coordinates for d5uipb1:

Click to download the PDB-style file with coordinates for d5uipb1.
(The format of our PDB-style files is described here.)

Timeline for d5uipb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5uipb2