Lineage for d5u7nb_ (5u7n B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2380192Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2380193Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2380835Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins)
  6. 2380836Protein Cytochrome c oxidase [49544] (4 species)
  7. 2380944Species Thermus thermophilus, ba3 type [TaxId:274] [49547] (37 PDB entries)
  8. 2380968Domain d5u7nb_: 5u7n B: [341887]
    automated match to d2llna_
    complexed with cu, mpd

Details for d5u7nb_

PDB Entry: 5u7n (more details), 2.3 Å

PDB Description: crystal structure of a chimeric cua domain (subunit ii) of cytochrome ba3 from thermus thermophilus with the amicyanin loop
PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d5u7nb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5u7nb_ b.6.1.2 (B:) Cytochrome c oxidase {Thermus thermophilus, ba3 type [TaxId: 274]}
gklervdpttvrqegpwadpaqavvqtgpnqytvyvlafafgyqpnpievpqgaeivfki
tspdvihgfhvegtninvevlpgevstvrytfkrpgeyriictphpfmfgtivvke

SCOPe Domain Coordinates for d5u7nb_:

Click to download the PDB-style file with coordinates for d5u7nb_.
(The format of our PDB-style files is described here.)

Timeline for d5u7nb_: