Lineage for d5t1hb_ (5t1h B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 protein domains)
    members organized in the groups and subfamiles specified by the comments
  6. 2544570Protein Protein kinase CK2, alpha subunit [56142] (3 species)
    CMGC group; CK2 subfamily; serine/threonine kinase
  7. 2544571Species Human (Homo sapiens) [TaxId:9606] [75559] (122 PDB entries)
  8. 2544662Domain d5t1hb_: 5t1h B: [341884]
    automated match to d3h30a_
    complexed with 75e, edo, so4

Details for d5t1hb_

PDB Entry: 5t1h (more details), 2.11 Å

PDB Description: crystal structure of ck2
PDB Compounds: (B:) Casein kinase II subunit alpha

SCOPe Domain Sequences for d5t1hb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t1hb_ d.144.1.7 (B:) Protein kinase CK2, alpha subunit {Human (Homo sapiens) [TaxId: 9606]}
sgpvpsrarvytdvnthrpreywdyeshvvewgnqddyqlvrklgrgkysevfeainitn
nekvvvkilkpvkkkkikreikilenlrggpniitladivkdpvsrtpalvfehvnntdf
kqlyqtltdydirfymyeilkaldychsmgimhrdvkphnvmidhehrklrlidwglaef
yhpgqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrkepffhghdnydq
lvriakvlgtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvspealdfl
dkllrydhqsrltareamehpyfytvvkdqa

SCOPe Domain Coordinates for d5t1hb_:

Click to download the PDB-style file with coordinates for d5t1hb_.
(The format of our PDB-style files is described here.)

Timeline for d5t1hb_: