SCOPe 2.06: Domain d5ovra1: 5ovr A:258-537

Lineage for d5ovra1 (5ovr A:258-537)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.0: automated matches [191381] (1 protein)
   not a true family

6. Protein automated matches [190475] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187400] (117 PDB entries)

8. Domain d5ovra1: 5ovr A:258-537 [341871]
   Other proteins in same PDB: d5ovra2
   automated match to d3o4ua_
   complexed with axk

Details for d5ovra1

PDB Entry: 5ovr, 2.15 Å

PDB Description: x-ray characterization of striatal-enriched protein tyrosine phosphatase inhibitors

PDB Compounds: (A:) Tyrosine-protein phosphatase non-receptor type 5

SCOPe Domain Sequences for d5ovra1:

Sequence; same for both SEQRES and ATOM records:

>d5ovra1 c.45.1.0 (A:258-537) automated matches {Human (Homo sapiens) [TaxId: 9606]}
srvlqaeelhekaldpfllqaeffeipmnfvdpkeydipglvrknryktilpnphsrvcl
tspdpddplssyinanyirgyggeekvyiatqgpivstvadfwrmvwqehtpiivmitni
eemnekcteywpeeqvaydgveitvqkvihtedyrlrlislksgteerglkhywftswpd
qktpdrappllhlvreveeaaqqegphcapiivhcsagigrtgcfiatsiccqqlrqegv
vdilkttcqlrqdrggmiqtceqyqfvhhvmslyekqlsh

Timeline for d5ovra1:

• d5ovra1 is new in SCOPe 2.06-stable
  
• d5ovra1 appears in SCOPe 2.07
  
• d5ovra1 appears in the current release, SCOPe 2.08