Lineage for d5ovra1 (5ovr A:258-537)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2116263Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 2116264Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 2116650Family c.45.1.0: automated matches [191381] (1 protein)
    not a true family
  6. 2116651Protein automated matches [190475] (8 species)
    not a true protein
  7. 2116663Species Human (Homo sapiens) [TaxId:9606] [187400] (116 PDB entries)
  8. 2298570Domain d5ovra1: 5ovr A:258-537 [341871]
    Other proteins in same PDB: d5ovra2
    automated match to d3o4ua_
    complexed with axk

Details for d5ovra1

PDB Entry: 5ovr (more details), 2.15 Å

PDB Description: x-ray characterization of striatal-enriched protein tyrosine phosphatase inhibitors
PDB Compounds: (A:) Tyrosine-protein phosphatase non-receptor type 5

SCOPe Domain Sequences for d5ovra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ovra1 c.45.1.0 (A:258-537) automated matches {Human (Homo sapiens) [TaxId: 9606]}
srvlqaeelhekaldpfllqaeffeipmnfvdpkeydipglvrknryktilpnphsrvcl
tspdpddplssyinanyirgyggeekvyiatqgpivstvadfwrmvwqehtpiivmitni
eemnekcteywpeeqvaydgveitvqkvihtedyrlrlislksgteerglkhywftswpd
qktpdrappllhlvreveeaaqqegphcapiivhcsagigrtgcfiatsiccqqlrqegv
vdilkttcqlrqdrggmiqtceqyqfvhhvmslyekqlsh

SCOPe Domain Coordinates for d5ovra1:

Click to download the PDB-style file with coordinates for d5ovra1.
(The format of our PDB-style files is described here.)

Timeline for d5ovra1:

  • d5ovra1 appears in periodic updates to SCOPe 2.06 starting on 2017-11-24

View in 3D
Domains from same chain:
(mouse over for more information)
d5ovra2