Lineage for d5p9wa_ (5p9w A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2129297Family c.66.1.1: COMT-like [53336] (4 protein domains)
  6. 2129308Protein Catechol O-methyltransferase, COMT [53337] (2 species)
  7. 2129320Species Norway rat (Rattus norvegicus) [TaxId:10116] [53338] (84 PDB entries)
  8. 2298568Domain d5p9wa_: 5p9w A: [341869]
    automated match to d1h1da_
    complexed with 7jn, cl, d1d, mg, nhe, so4

Details for d5p9wa_

PDB Entry: 5p9w (more details), 1.43 Å

PDB Description: rat catechol o-methyltransferase in complex with 4'-fluoro-4,5- dihydroxy-n-{[(1r,2r)-2-{(2s,4r,5r)-4-hydroxy-5-[6-(methylamino)-9h- purin-9-yl]oxolan-2-yl}cyclopropyl]methyl}[1,1'-biphenyl]-3- carboxamide
PDB Compounds: (A:) Catechol O-methyltransferase

SCOPe Domain Sequences for d5p9wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5p9wa_ c.66.1.1 (A:) Catechol O-methyltransferase, COMT {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dtkeqrilryvqqnakpgdpqsvleaidtyctqkewamnvgdakgqimdavireyspslv
lelgaycgysavrmarllqpgarlltmemnpdyaaitqqmlnfaglqdkvtilngasqdl
ipqlkkkydvdtldmvfldhwkdrylpdtlllekcgllrkgtvlladnvivpgtpdflay
vrgsssfecthyssyleymkvvdglekaiyqgp

SCOPe Domain Coordinates for d5p9wa_:

Click to download the PDB-style file with coordinates for d5p9wa_.
(The format of our PDB-style files is described here.)

Timeline for d5p9wa_:

  • d5p9wa_ appears in periodic updates to SCOPe 2.06 starting on 2017-11-24