SCOPe 2.08: Domain d5ojgb_: 5ojg B:

Lineage for d5ojgb_ (5ojg B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Nematode (Caenorhabditis elegans) [TaxId:6239] [237812] (4 PDB entries)

8. Domain d5ojgb_: 5ojg B: [341860]
   automated match to d4za2a_
   complexed with buo, nap

Details for d5ojgb_

PDB Entry: 5ojg, 1.9 Å

PDB Description: crystal structure of the dehydrogenase/reductase sdr family member 4 (dhrs4) from caenorhabditis elegans

PDB Compounds: (B:) Dehydrogenase/reductase SDR family member 4

SCOPe Domain Sequences for d5ojgb_:

Sequence; same for both SEQRES and ATOM records:

>d5ojgb_ c.2.1.0 (B:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
mpsncrrfegkvaivtaatkgiglaiaerlldegasvvigsrnqknvdeaieylknkglt
kvagiaghiastddqkklvdftlqkfgkinilvnnhginpafghilevsdqvwdklfevn
vkagfqmtklvhphiakegggaiifnasysayksppgiaaygvtkttlvgltralamgla
kdnirvngiapgviktkmsqvlwdggedaekeltdiqeialgrlgvpddcagtvaylasd
dssyitgemiiiaggvqarl

Timeline for d5ojgb_:

• d5ojgb_ first appeared in SCOPe 2.06
  
• d5ojgb_ appears in SCOPe 2.07