Lineage for d5p9na_ (5p9n A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2129297Family c.66.1.1: COMT-like [53336] (4 protein domains)
  6. 2129308Protein Catechol O-methyltransferase, COMT [53337] (2 species)
  7. 2129320Species Norway rat (Rattus norvegicus) [TaxId:10116] [53338] (84 PDB entries)
  8. 2298549Domain d5p9na_: 5p9n A: [341850]
    automated match to d4pyna_
    complexed with 7je, 8je, cl, d1d, mg, nhe, so4

Details for d5p9na_

PDB Entry: 5p9n (more details), 1.17 Å

PDB Description: humanized rat comt in complex with 5-(4-fluorophenyl)-2,3-dihydroxy-n- [[3-[hydroxy-(1-methylindazol-5-yl)methyl]phenyl]methyl]benzamide at 1.17a
PDB Compounds: (A:) Catechol O-methyltransferase

SCOPe Domain Sequences for d5p9na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5p9na_ c.66.1.1 (A:) Catechol O-methyltransferase, COMT {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dtkeqrilryvqqnakpgdpqsvleaidtyctqkewamnvgdakgqimdavireyspslv
lelgaycgysavrmarllqpgarlltmeinpdcaaitqqmlnfaglqdkvtilngasqdl
ipqlkkkydvdtldmvfldhwkdrylpdtlllekcgllrkgtvlladnvivpgtpdflay
vrgsssfecthyssyleymkvvdglekaiyqgp

SCOPe Domain Coordinates for d5p9na_:

Click to download the PDB-style file with coordinates for d5p9na_.
(The format of our PDB-style files is described here.)

Timeline for d5p9na_:

  • d5p9na_ appears in periodic updates to SCOPe 2.06 starting on 2017-11-24