Lineage for d5oxha_ (5oxh A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2158219Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2158220Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2158221Family d.15.1.1: Ubiquitin-related [54237] (39 protein domains)
    Pfam PF00240
  6. 2158943Protein automated matches [190118] (12 species)
    not a true protein
  7. 2158968Species Human (Homo sapiens) [TaxId:9606] [189560] (94 PDB entries)
  8. 2298548Domain d5oxha_: 5oxh A: [341849]
    automated match to d2k39a_
    complexed with so4; mutant

Details for d5oxha_

PDB Entry: 5oxh (more details), 1.6 Å

PDB Description: c-terminally retracted ubiquitin t66v/l67n mutant
PDB Compounds: (A:) Ubiquitin T66V/L67N mutant

SCOPe Domain Sequences for d5oxha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5oxha_ d.15.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
iqkesvnhlvlrlrgg

SCOPe Domain Coordinates for d5oxha_:

Click to download the PDB-style file with coordinates for d5oxha_.
(The format of our PDB-style files is described here.)

Timeline for d5oxha_:

  • d5oxha_ appears in periodic updates to SCOPe 2.06 starting on 2017-11-24