Lineage for d5ojia_ (5oji A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2106799Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2106800Protein automated matches [190069] (239 species)
    not a true protein
  7. 2108268Species Nematode (Caenorhabditis elegans) [TaxId:6239] [237812] (4 PDB entries)
  8. 2108271Domain d5ojia_: 5oji A: [341837]
    automated match to d4za2a_
    complexed with isn, nap

Details for d5ojia_

PDB Entry: 5oji (more details), 1.6 Å

PDB Description: crystal structure of the dehydrogenase/reductase sdr family member 4 (dhrs4) from caenorhabditis elegans
PDB Compounds: (A:) Dehydrogenase/reductase SDR family member 4

SCOPe Domain Sequences for d5ojia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ojia_ c.2.1.0 (A:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
mpsncrrfegkvaivtaatkgiglaiaerlldegasvvigsrnqknvdeaieylknkglt
kvagiaghiastddqkklvdftlqkfgkinilvnnhginpafghilevsdqvwdklfevn
vkagfqmtklvhphiakegggaiifnasysayksppgiaaygvtkttlvgltralamgla
kdnirvngiapgviktkmsqvlwdggedaekeltdiqeialgrlgvpddcagtvaylasd
dssyitgemiiiaggvqarl

SCOPe Domain Coordinates for d5ojia_:

Click to download the PDB-style file with coordinates for d5ojia_.
(The format of our PDB-style files is described here.)

Timeline for d5ojia_: