Lineage for d6blba2 (6blb A:260-338)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982196Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1983660Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 1983661Protein automated matches [190154] (68 species)
    not a true protein
  7. 1983938Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [256270] (2 PDB entries)
  8. 2298531Domain d6blba2: 6blb A:260-338 [341832]
    Other proteins in same PDB: d6blba1
    automated match to d1in4a1
    protein/DNA complex; complexed with adp, pge

Details for d6blba2

PDB Entry: 6blb (more details), 1.88 Å

PDB Description: 1.88 angstrom resolution crystal structure holliday junction atp- dependent dna helicase (ruvb) from pseudomonas aeruginosa in complex with adp
PDB Compounds: (A:) Holliday junction ATP-dependent DNA helicase ruvB

SCOPe Domain Sequences for d6blba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6blba2 a.4.5.0 (A:260-338) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
rgfdhldrrllltmidkfdggpvgidnlaaalseerhtiedvlepyliqqgyimrtprgr
vvtrhaylhfglnipkrlg

SCOPe Domain Coordinates for d6blba2:

Click to download the PDB-style file with coordinates for d6blba2.
(The format of our PDB-style files is described here.)

Timeline for d6blba2:

  • d6blba2 appears in periodic updates to SCOPe 2.06 starting on 2017-11-24

View in 3D
Domains from same chain:
(mouse over for more information)
d6blba1