Lineage for d6blba1 (6blb A:23-259)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (130 species)
    not a true protein
  7. 2114605Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [226294] (11 PDB entries)
  8. 2298530Domain d6blba1: 6blb A:23-259 [341831]
    Other proteins in same PDB: d6blba2
    automated match to d1j7ka2
    protein/DNA complex; complexed with adp, pge

Details for d6blba1

PDB Entry: 6blb (more details), 1.88 Å

PDB Description: 1.88 angstrom resolution crystal structure holliday junction atp- dependent dna helicase (ruvb) from pseudomonas aeruginosa in complex with adp
PDB Compounds: (A:) Holliday junction ATP-dependent DNA helicase ruvB

SCOPe Domain Sequences for d6blba1:

Sequence, based on SEQRES records: (download)

>d6blba1 c.37.1.0 (A:23-259) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
airplkladyigqpsvreqmelfihaargrqealdhtlifgppglgkttlaniiaqemgv
sikstsgpvlerpgdlaalltnleagdvlfvdeihrlspiveevlypamedfqldimige
gpaarsikldlppftlvgattragmltnplrdrfgivqrlefynvedlativsrsagilg
leiepqgaaeiakrargtprianrllrrvrdfaevrgqgditrviadkalnlldvde

Sequence, based on observed residues (ATOM records): (download)

>d6blba1 c.37.1.0 (A:23-259) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
airplkladyigqpsvreqmelfihaargrqealdhtlifgppglgkttlaniiaqemgv
sikstsgpvlerpgdlaalltnleagdvlfvdeihrlspiveevlypamedfqldimiar
sikldlppftlvgattragmltnplrdrfgivqrlefynvedlativsrsagilgleiep
qgaaeiakrargtprianrllrrvrdfaevrgqgditrviadkalnlldvde

SCOPe Domain Coordinates for d6blba1:

Click to download the PDB-style file with coordinates for d6blba1.
(The format of our PDB-style files is described here.)

Timeline for d6blba1:

  • d6blba1 appears in periodic updates to SCOPe 2.06 starting on 2017-11-24

View in 3D
Domains from same chain:
(mouse over for more information)
d6blba2