Lineage for d5ongb_ (5ong B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1986516Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1986517Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 1986518Family a.22.1.1: Nucleosome core histones [47114] (6 protein domains)
    form octamers composed of two copies of each of the four histones
  6. 1986832Protein Histone H4 [47125] (7 species)
  7. 1986833Species African clawed frog (Xenopus laevis) [TaxId:8355] [47127] (57 PDB entries)
  8. 2298529Domain d5ongb_: 5ong B: [341830]
    Other proteins in same PDB: d5ongc_, d5ongd_, d5ongg_, d5ongh_
    automated match to d1tzyd_
    complexed with cl, mn

Details for d5ongb_

PDB Entry: 5ong (more details), 2.8 Å

PDB Description: x-ray crystal structure of a nucleosome core particle with its dna site-specifically crosslinked to the histone octamer
PDB Compounds: (B:) histone h4

SCOPe Domain Sequences for d5ongb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ongb_ a.22.1.1 (B:) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
niqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvtam
dvvyalkrqgrtlygfgg

SCOPe Domain Coordinates for d5ongb_:

Click to download the PDB-style file with coordinates for d5ongb_.
(The format of our PDB-style files is described here.)

Timeline for d5ongb_:

  • d5ongb_ appears in periodic updates to SCOPe 2.06 starting on 2017-11-24