SCOPe 2.06: Domain d2o90a_: 2o90 A:

Lineage for d2o90a_ (2o90 A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.96: T-fold [55619] (2 superfamilies)
   beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
   tunnel-shaped: its known members form wide oligomeric barrels different sizes

4. Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families)
   bind purine or pterin in topologically similar sites between subunits

5. Family d.96.1.0: automated matches [227243] (1 protein)
   not a true family

6. Protein automated matches [227009] (13 species)
   not a true protein

7. Species Escherichia coli [311232] (2 PDB entries)

8. Domain d2o90a_: 2o90 A: [341828]
   automated match to d2o9mb_
   complexed with neu

Details for d2o90a_

PDB Entry: 2o90, 1.07 Å

PDB Description: atomic resolution crystal structure of e.coli dihydroneopterin aldolase in complex with neopterin

PDB Compounds: (A:) dihydroneopterin aldolase

SCOPe Domain Sequences for d2o90a_:

Sequence; same for both SEQRES and ATOM records:

>d2o90a_ d.96.1.0 (A:) automated matches {Escherichia coli}
mdivfieqlsvittigvydweqtieqklvfdiemawdnrkaaksddvadclsyadiaetv
vshvegarfalvervaeevaelllarfnspwvriklskpgavaraanvgviierg

Timeline for d2o90a_:

• d2o90a_ is new in SCOPe 2.06-stable
  
• d2o90a_ appears in SCOPe 2.07
  
• d2o90a_ appears in the current release, SCOPe 2.08