Lineage for d2o90a_ (2o90 A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2185755Fold d.96: T-fold [55619] (2 superfamilies)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
    tunnel-shaped: its known members form wide oligomeric barrels different sizes
  4. 2185756Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) (S)
    bind purine or pterin in topologically similar sites between subunits
  5. 2186309Family d.96.1.0: automated matches [227243] (1 protein)
    not a true family
  6. 2186310Protein automated matches [227009] (13 species)
    not a true protein
  7. 2186350Species Escherichia coli [311232] (2 PDB entries)
  8. 2298527Domain d2o90a_: 2o90 A: [341828]
    automated match to d2o9mb_
    complexed with neu

Details for d2o90a_

PDB Entry: 2o90 (more details), 1.07 Å

PDB Description: atomic resolution crystal structure of e.coli dihydroneopterin aldolase in complex with neopterin
PDB Compounds: (A:) dihydroneopterin aldolase

SCOPe Domain Sequences for d2o90a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o90a_ d.96.1.0 (A:) automated matches {Escherichia coli}
mdivfieqlsvittigvydweqtieqklvfdiemawdnrkaaksddvadclsyadiaetv
vshvegarfalvervaeevaelllarfnspwvriklskpgavaraanvgviierg

SCOPe Domain Coordinates for d2o90a_:

Click to download the PDB-style file with coordinates for d2o90a_.
(The format of our PDB-style files is described here.)

Timeline for d2o90a_:

  • d2o90a_ appears in periodic updates to SCOPe 2.06 starting on 2017-11-24