SCOPe 2.08: Domain d6b9jb1: 6b9j B:2-108

Lineage for d6b9jb1 (6b9j B:2-108)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)

8. Domain d6b9jb1: 6b9j B:2-108 [341825]
   Other proteins in same PDB: d6b9ja_, d6b9jb2, d6b9jh_, d6b9jl2, d6b9jx1, d6b9jx2, d6b9jy1, d6b9jy2
   automated match to d1dn0a1
   complexed with gol, na

Details for d6b9jb1

PDB Entry: 6b9j, 2.9 Å

PDB Description: structure of vaccinia virus d8 protein bound to human fab vv138

PDB Compounds: (B:) Fab vv138 Light chain

SCOPe Domain Sequences for d6b9jb1:

Sequence, based on SEQRES records:

>d6b9jb1 b.1.1.1 (B:2-108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ivltqspgtlslspgeratlscrasqsvtstylawhqqkpgqaprlliysassratgipd
rfsgsgsgtdftltisrlepedfavyycqqygssppytfgqgtkvdi

Sequence, based on observed residues (ATOM records):

>d6b9jb1 b.1.1.1 (B:2-108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ivltqspgtlslspgeratlscrasqsvtstylawhqqkpgqaprlliysassratgipd
rfsgsgstdftltisrlepedfavyycqqygssppytfgqgtkvdi

Timeline for d6b9jb1:

• d6b9jb1 first appeared in SCOPe 2.06
  
• d6b9jb1 appears in SCOPe 2.07