Lineage for d5nl9a1 (5nl9 A:1-145)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982196Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1983660Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 1983661Protein automated matches [190154] (68 species)
    not a true protein
  7. 2298517Species Leptospira interrogans [TaxId:267671] [341818] (1 PDB entry)
  8. 2298518Domain d5nl9a1: 5nl9 A:1-145 [341819]
    Other proteins in same PDB: d5nl9a2, d5nl9b2
    automated match to d4rb3c_
    complexed with k, unx, zn

Details for d5nl9a1

PDB Entry: 5nl9 (more details), 1.9 Å

PDB Description: crystal structure of a peroxide stress regulator from leptospira interrogans
PDB Compounds: (A:) Transcriptional regulator (FUR family)

SCOPe Domain Sequences for d5nl9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nl9a1 a.4.5.0 (A:1-145) automated matches {Leptospira interrogans [TaxId: 267671]}
mkdsyerskkiledaginvtvqrlqmanlllskpqhltadqvfqlinehmpnasratifn
nlklfaekgivnllelksgitlydsnvihhhhaidektgeiydisldsklqekvlselkq
dfklktgsslencnlsitlkgkknp

SCOPe Domain Coordinates for d5nl9a1:

Click to download the PDB-style file with coordinates for d5nl9a1.
(The format of our PDB-style files is described here.)

Timeline for d5nl9a1:

  • d5nl9a1 appears in periodic updates to SCOPe 2.06 starting on 2017-11-24

View in 3D
Domains from same chain:
(mouse over for more information)
d5nl9a2