Lineage for d5h74e_ (5h74 E:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2012335Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 2012522Superfamily a.137.10: Stathmin [101494] (1 family) (S)
    single long helix crosslinking four tubulin subunits
    automatically mapped to Pfam PF00836
  5. 2012523Family a.137.10.1: Stathmin [101495] (2 protein domains)
  6. 2012524Protein Stathmin 4 [101496] (1 species)
  7. 2012525Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (69 PDB entries)
  8. 2298511Domain d5h74e_: 5h74 E: [341812]
    Other proteins in same PDB: d5h74a1, d5h74a2, d5h74b1, d5h74b2, d5h74c1, d5h74c2, d5h74d1, d5h74d2, d5h74f1, d5h74f2, d5h74f3
    automated match to d4i55e_
    complexed with 7lg, acp, ca, gdp, gtp, mes, mg

Details for d5h74e_

PDB Entry: 5h74 (more details), 2.6 Å

PDB Description: crystal structure of t2r-ttl-14b complex
PDB Compounds: (E:) Stathmin-4

SCOPe Domain Sequences for d5h74e_:

Sequence, based on SEQRES records: (download)

>d5h74e_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe
aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe
kdkhaeevrknkelke

Sequence, based on observed residues (ATOM records): (download)

>d5h74e_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsdpsleeiqkkleaaeerrkyqeaellkhlaekreher
eviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelk
e

SCOPe Domain Coordinates for d5h74e_:

Click to download the PDB-style file with coordinates for d5h74e_.
(The format of our PDB-style files is described here.)

Timeline for d5h74e_:

  • d5h74e_ appears in periodic updates to SCOPe 2.06 starting on 2017-11-24